Sökresultat
Filtrera
Filtyp
Din sökning på "*" gav 564128 sökträffar
Atomic-Scale Tuning of Graphene/Cubic SiC Schottky Junction for Stable Low-Bias Photoelectrochemical Solar-to-Fuel Conversion
Engineering tunable graphene-semiconductor interfaces while simultaneously preserving the superior properties of graphene is critical to graphene-based devices for electronic, optoelectronic, biomedical, and photoelectrochemical applications. Here, we demonstrate this challenge can be surmounted by constructing an interesting atomic Schottky junction via epitaxial growth of high-quality and unifor
Modelling heat recovery potential from household wastewater
There is a strongly growing interest for wastewater heat recovery (WWHR) in Sweden and elsewhere, but a lack of adequate tools to determine downstream impacts due to the associated temperature drop. The heat recovery potential and associated temperature drop after heat recovery on a building level is modelled for a case study in Linköping, Sweden. The maximum temperature drop reaches 4.2 °C, with
Calculation of the effective external dose rate to a person staying in the resettlement zone of the Vetka district of the Gomel region of Belarus based on in situ and ex situ assessments in 2016–2018
The aim of this study was to perform a preliminary assessment of the expected effective dose rate from external exposure to an adult individual staying at that part of the radioactively contaminated territory of the Vetka district of the Gomel region of the Republic of Belarus, from where residents had been resettled after the Chernobyl accident. For this assessment, in summer 2016 and 2018 soil s
Travel time and perinatal mortality after emergency caesarean sections : An evaluation of the 2-hour proximity indicator in Sierra Leone
Introduction Longer travel times are associated with increased adverse maternal and perinatal outcomes. Geospatial modelling has been increasingly used to estimate geographic proximity in emergency obstetric care. In this study, we aimed to assess the correlation between modelled and patient-reported travel times and to evaluate its clinical relevance. Methods Women who delivered by caesarean sect
Central exclusive production of scalar and pseudoscalar charmonia in the light-front kT -factorization approach
We study exclusive production of scalar χc0χc(0++) and pseudoscalar ηc charmonia states in proton-proton collisions at the LHC energies. The amplitudes for gg→χc0 as well as for gg→ηc mechanisms are derived in the kT-factorization approach. The pp→ppηc reaction is discussed for the first time. We have calculated rapidity, transverse momentum distributions, and such correlation observables as the d
Search for Heavy Resonances Decaying into a Photon and a Hadronically Decaying Higgs Boson in pp Collisions at s =13 TeV with the ATLAS Detector
This Letter presents a search for the production of new heavy resonances decaying into a Higgs boson and a photon using proton-proton collision data at s=13 TeV collected by the ATLAS detector at the LHC. The data correspond to an integrated luminosity of 139 fb-1. The analysis is performed by reconstructing hadronically decaying Higgs boson (H→bb¯) candidates as single large-radius jets. A novel
Membrane interactions of antimicrobial peptide-loaded microgels
In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta potential, ellipsometry, and circul
Micro(RNA) Management and Mismanagement of the Islet
Pancreatic β-cells located within the islets of Langerhans play a central role in metabolic control. The main function of these cells is to produce and secrete insulin in response to a rise in circulating levels of glucose and other nutrients. The release of insufficient insulin to cover the organism needs results in chronic hyperglycemia and diabetes development. β-cells insure a highly specializ
Microparticle acoustophoresis in aluminum-based acoustofluidic devices with PDMS covers
We present a numerical model for the recently introduced simple and inexpensive micromachined aluminum devices with a polydimethylsiloxane (PDMS) cover for microparticle acoustophoresis. We validate the model experimentally for a basic design, where a microchannel is milled into the surface of an aluminum substrate, sealed with a PDMS cover, and driven at MHz frequencies by a piezoelectric lead-zi
Are judges influenced by legally irrelevant circumstances?
Judges should not be influenced by legally irrelevant circumstances in their legal decision making and judges generally believe that they manage legally irrelevant circumstances well. The purpose of this experimental study was to investigate whether this self-image is correct. Swedish judges (N = 256) read a vignette depicting a case of libel, where a female student had claimed on her blog that sh
Inhibition of NFAT signaling restores microvascular endothelial function in diabetic mice
Central to the development of diabetic macro- and microvascular disease is endothelial dysfunction, which appears well before any clinical sign but, importantly, is potentially reversible. We previously demonstrated that hyperglycemia activates nuclear factor of activated T cells (NFAT) in conduit and medium-sized resistance arteries and that NFAT blockade abolishes diabetes-driven aggravation of
Mapping mafic dyke swarms, structural features, and hydrothermal alteration zones in Atar, Ahmeyim and Chami areas (Reguibat Shield, Northern Mauritania) using high-resolution aeromagnetic and gamma-ray spectrometry data
Analysis of an airborne geophysical data covering the Tasiast-Tijirit Terrane in the western part of the Reguibat Shield (including the 1:200,000 geological sheets of Chami, Ahmeyim and Atar), provided an improved mapping of mafic dyke swarms, structural features, and hydrothermal alteration zones. It also extended the mapping into extensive areas covered by sand. A low-altitude (100 m) airborne s
Lower 68Ga-DOTATOC uptake in nonfunctioning pituitary neuroendocrine tumours compared to normal pituitary gland—A proof-of-concept study
Objectives: 68Ga-DOTATOC PET targets somatostatin receptors (SSTRs) and is well established for the detection of SSTR-expressing tumors, such as gastrointestinal neuroendocrine tumors. Pituitary adenomas, recently designated as pituitary neuroendocrine tumors (PitNETs), also express SSTRs, but there has been no previous evaluations of 68Ga-DOTATOC PET in PitNET patients. The aim of this pilot stud
Hyperbaric oxygen therapy in diabetic foot ulceration : Useless or useful? A battle
The use of hyperbaric oxygen therapy (HBO) in the treatment of certain types of diabetic foot ulcers (DFU) has been the topic of much debate and disagreement over the last several decades. In this review, the evidence for its use is presented and discussed by two experts in DFU management. Whereas some randomized controlled trials suggest that HBO may speed the healing of certain ischaemic or neur
DIFFUSE RETINAL VASCULAR LEAKAGE AND CONE-ROD DYSTROPHY IN A FAMILY WITH THE HOMOZYGOUS MISSENSE C.1429G>A (P.GLY477ARG) MUTATION IN CRB1
PURPOSE: To describe a specific cone-rod dystrophy phenotype in a family with the homozygous c.1429G>A; p.Gly477Arg mutation in CRB1. The detailed phenotype of subjects with this specific mutation has not been described previously. METHODS: Clinical examination included full-field electroretinography and high-resolution and widefield retinal imaging and uveitis workup. Molecular genetic analysis i
Gold nanoparticles incorporated into cryogel walls for efficient nitrophenol conversion
The past several decades have illustrated an enormous interest in noble metal nanoparticles for their superior catalytic activity, however, their industrial use is very restricted due to inefficient recovery leading to potential contamination of products and the environment. Immobilised nanoparticles illustrate promising results for scaling up processes, and can be successfully applied for various
Search for resonances decaying into a weak vector boson and a Higgs boson in the fully hadronic final state produced in proton-proton collisions at s =13 TeV with the ATLAS detector
A search for heavy resonances decaying into a W or Z boson and a Higgs boson produced in proton-proton collisions at the Large Hadron Collider at s=13 TeV is presented. The analysis utilizes the dominant W→qq¯′ or Z→qq¯ and H→bb¯ decays with substructure techniques applied to large-radius jets. A sample corresponding to an integrated luminosity of 139 fb-1 collected with the ATLAS detector is anal
Kejsaren som fick se sin värld falla samman
Review of H. Schilling, Karl V. Der Kaiser dem die Welt zerbrach
The GALAH survey : A new constraint on cosmological lithium and Galactic lithium evolution from warm dwarf stars
Lithium depletion and enrichment in the cosmos is not yet well understood. To help tighten constraints on stellar and Galactic evolution models, we present the largest high-resolution analysis of Li abundances A(Li) to date, with results for over $100\, 000$ GALAH (Galactic Archeology with HERMES) field stars spanning effective temperatures $5900\, \mathrm{K} \lesssim T_{\mathrm{eff}}\lesssim 7000
